PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29889.m003388
Common NameLOC8261341, RCOM_1003460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 1026aa    MW: 114102 Da    PI: 7.8137
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29889.m003388genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.6e-41150227178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  29889.m003388 150 VCQVEDCSADLSNAKDYHRRHKVCDMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 227
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.7E-33145212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.248148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-38149230IPR004333Transcription factor, SBP-box
PfamPF031103.6E-29151224IPR004333Transcription factor, SBP-box
SMARTSM00248290793822IPR002110Ankyrin repeat
SuperFamilySSF484034.97E-8796912IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.6E-7797924IPR020683Ankyrin repeat-containing domain
CDDcd002042.24E-8798927No hitNo description
SMARTSM0024822850880IPR002110Ankyrin repeat
SMARTSM00248480890919IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1026 aa     Download sequence    Send to blast
MEAKVRGKSH HFYGPVVSDM KAAGKKSLDW DLNDWKWDGD LFTASPLNSV PSDCRNKQLF  60
PVGAEIPQNG GLFNTSASGS DNNNDLDNEK GKRELEKRRR VVVVEDEDLP ADEAGSLILK  120
LGGQAYPIVD EDAKCGKKTK FIGNASNRAV CQVEDCSADL SNAKDYHRRH KVCDMHSKAS  180
KALVGNVMQR FCQQCSRFHV LQEFDEGKRS CRRRLAGHNR RRRKTHPENV VNGASLNDEK  240
GSSYLLISLL RILSNLHSNS SDQEKNQDLL SHLLRNLASL AGATSEGSIS KVLQESQALE  300
NAGKTAGTLG KGSDKITTGF ESAGPSTMAC KSSEDIVRPL GQGGAVPVSD LAQKSVWDGT  360
PQPMPSSTST KFFPSRCDFP AKIKEPKAAV GRIKFNNIDL NNVYDGSQDS AGNLELSPAP  420
LIPGTGSINC PLWLQSGFHK RSLPQMSGNS DSTSSQSPSS SSGEAQSCTD RIVFKLFGKD  480
PNDFPITLRT QILDWLSHSP TDIESYIRPG CIILTIYLRL GKPEWEEICI DLGARLSKLL  540
DGSTDSFWRT GWVYARVQHC VSFIYNGQVV LDTPLPLKSH KHCRISSIKP IAVTLSERTD  600
FTVKGFNIFR PSTRLLCALE GKYLVQETSR DLMDGADTTN EHNKLQCLTF PCSIPNIIGR  660
GFVEVEDHGL SSSFFPFIVA EKEVCSEICL LEEALEVPET ADGMHKNTER IEAKNQALDF  720
VNEMGWLLHR SRLKFRLGDL YPNLDLFPFR RYKWLIEFSM DHDWCAVVKK LLAILFDGTV  780
DTGEHSSIEL ALLDMGLLHR AVQRNCRSMV ELLLRYVPDK EFGRSGLEQR QEVDGGYKSF  840
IFKPDDVGPG GLTPLHVAAI RDGSENILDA LTDDPGFVGI EAWRRARDST GLTPNDYACL  900
RGHYSYIHLI QRKINTKSEN GHVVLDIPRT LVDCNTKQKD GLKSSKFYGL QIGRMEMNTT  960
KRHCRLCEQK LARGQSRTSL VYRPAMLSMV AIAAVCVCVA LLFKSSPEVL YVFQPFRWEL  1020
VKYGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301502241084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196100KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519316.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLB9RZZ70.0B9RZZ7_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12